discontinued

H00009589-M01 WT1 / Wilms tumor protein antibody

See related secondary antibodies

Search for all "WT1 / Wilms tumor protein"

Quick Overview

Mouse anti Human WT1 / Wilms tumor protein 1B11

Product Description for WT1 / Wilms tumor protein

Mouse anti Human WT1 / Wilms tumor protein 1B11.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot, Paraffin Sections.

Properties for WT1 / Wilms tumor protein

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms WT33
Presentation Purified
Reactivity Hu
Applications E, P, WB
Clonality Monoclonal
Clone 1B11
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P19544
Immunogen:
WTAP (NP_690596, 70 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
ARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAW KFTPDR*
GeneID:
7490
Remarks:
Gene Accession: NM_152857
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant WTAP.

Antibody Reactive Against Recombinant Protein.
Application ELISA,IHC-P,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 9589

Accessory Products

Proteins and/or Positive Controls

Proteins for WT1 / Wilms tumor protein (7 products)

Catalog No. Species Pres. Purity   Source  

WT1 / Wilms tumor protein (full length, N-term HIS tag, transcript variant B)

WT1 / Wilms tumor protein Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

WT1 / Wilms tumor protein (full length, N-term HIS tag, transcript variant A)

WT1 / Wilms tumor protein Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for WT1 / Wilms tumor protein (1 products)

Catalog No. Species Pres. Purity   Source  

Wilms Tumor 1 Lysate

Western Blot: Wilms Tumor 1 Lysate [NBL1-17887] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WT1
  Novus Biologicals Inc.
  • LinkedIn