TA329197 WT1 / Wilms tumor protein antibody

Rabbit Polyclonal anti-WT1 Antibody

See related secondary antibodies

Search for all "WT1 / Wilms tumor protein"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human WT1 / Wilms tumor protein

Product Description for WT1 / Wilms tumor protein

Rabbit anti Human WT1 / Wilms tumor protein.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for WT1 / Wilms tumor protein

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms WT33
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-WT1 antibody is: synthetic peptide directed towards the N-terminal region of Human WT1. Synthetic peptide located within the following region: DFAPPGASAYGSLGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQC.
Application WB
Background WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a small subset of patients with Wilm's tumors. Multiple transcript variants, resulting from alternative splicing at two coding exons, have been well characterized. There is also evidence for the use of non-AUG (CUG) translation initiation site upstream of, and in-frame with the first AUG, leading to additional isoforms.
Affinity Purified
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for WT1 / Wilms tumor protein (7 products)

Catalog No. Species Pres. Purity   Source  

WT1 / Wilms tumor protein (full length, N-term HIS tag, transcript variant B)

WT1 / Wilms tumor protein Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

WT1 / Wilms tumor protein (full length, N-term HIS tag, transcript variant A)

WT1 / Wilms tumor protein Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

WT1 / Wilms tumor protein

WT1 / Wilms tumor protein Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for WT1 / Wilms tumor protein (1 products)

Catalog No. Species Pres. Purity   Source  

Wilms Tumor 1 Lysate

Western Blot: Wilms Tumor 1 Lysate [NBL1-17887] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for WT1
  Novus Biologicals Inc.
  • LinkedIn