H00126374-B01P WTIP antibody

See related secondary antibodies

Search for all "WTIP"

50 µg / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human WTIP

H00126374-B01P

Product Description for WTIP

Mouse anti Human WTIP.
Product is tested for Western blot / Immunoblot.

Properties for WTIP

Product Category Primary Antibodies
Quantity 50 µg
Synonyms -
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6NIX2
Immunogen:
WTIP (AAI60027.1, 1 a.a. ~ 430 a.a) full-length human protein.
AA Sequence:
MQRSRAGADEAALLLAGLALRELEPGCGSPGRGRRGPRPGPGDEAAPALGRRGKGSGGPEAGADGLSRGERGPRRA AVPELSAQPAGSPRASLAGSDGGGGGGSARSSGISLGYDQRHGSPRSGRSDPRPGPGPPSVGSARSSVSSLGSRGS AGAYADFLPPGACPAPARSPEPAGPAPFPLPALPLPPGREGGPSAAERRLEALTRELERALEARTARDYFGICIKC GLGIYGAQQACQAMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEMILQA LGKSYHPGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHVAC YHCEDCGLQLSGEEGRRCYPLAGHLLCRRCHLRRLQPGPLPSPTVHVTEL
GeneID:
126374
Add. information Mouse polyclonal antibody raised against a full-length human WTIP protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for WTIP (1 products)

Catalog No. Species Pres. Purity   Source  

Wilms tumor 1 interacting protein (WTIP)

Wilms tumor 1 interacting protein (WTIP) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for WTIP (1 products)

Catalog No. Species Pres. Purity   Source  

WTIP overexpression lysate

WTIP overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn