discontinued

H00009942-B01 XYLB / Xylulokinase antibody

See related secondary antibodies

Search for all "XYLB / Xylulokinase"

Quick Overview

Mouse anti Human XYLB / Xylulokinase

Product Description for XYLB / Xylulokinase

Mouse anti Human XYLB / Xylulokinase.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for XYLB / Xylulokinase

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Xylulose kinase
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O75191
Immunogen:
XYLB (NP_005099.2, 1 a.a. ~ 536 a.a) full-length human protein.
AA Sequence:
MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLTVTSPVLMWVQALDIIL EKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLRLHQQLQDCFSISDCPVWMDSSTTAQCRQLEAA VGGAQALSCLTGSRAYERFTGNQIAKIYQQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKV WSQACLGACAPHLEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLGTSDT LFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVM EITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKRIHAEGLGYRVMSKTKILATGGASHNREILQVLADVF DAPVYVIDTANSACVGSAYRAFHGLAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTR GPPE
GeneID:
9942
Remarks:
Gene Accession: NM_005108.2
Add. information Mouse polyclonal antibody raised against a full-length human XYLB protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 9942

Accessory Products

Proteins and/or Positive Controls

Proteins for XYLB / Xylulokinase (5 products)

Catalog No. Species Pres. Purity   Source  

XYLB / Xylulokinase

XYLB / Xylulokinase Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €398.00

  OriGene Technologies, Inc.

XYLB / Xylulokinase

XYLB / Xylulokinase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

XYLB / Xylulokinase

XYLB / Xylulokinase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

XYLB / Xylulokinase

XYLB / Xylulokinase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

XYLB / Xylulokinase

XYLB / Xylulokinase Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for XYLB / Xylulokinase (2 products)

Catalog No. Species Pres. Purity   Source  

XYLB 293T Cell Transient Overexpression Lysate(Denatured)

XYLB 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

XYLB overexpression lysate

XYLB overexpression lysate
0.1 mg / €480.00
  OriGene Technologies, Inc.
  • LinkedIn