TA332234 YARS2 antibody

Rabbit Polyclonal Anti-YARS2 Antibody

See related secondary antibodies

Search for all "YARS2"

50 µg / €360.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat YARS2

Product Description for YARS2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat YARS2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for YARS2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms CGI-04, TyrRS, Tyrosine-tRNA ligase, Tyrosyl-tRNA synthetase mitochondrial
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2Z4
Immunogen:
The immunogen for Anti-YARS2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YARS2. Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH.
GeneID:
51067
Application WB
Background This gene encodes a mitochondrial protein that catalyzes the attachment of tyrosine to tR(Tyr). Mutations in this gene are associated with myopathy with lactic acidosis and sideroblastic anemia type 2 (MLASA2).
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for YARS2 (5 products)

Catalog No. Species Pres. Purity   Source  

YARS2

YARS2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

YARS2 (17-477, His-tag)

YARS2 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €730.00
  Acris Antibodies GmbH

YARS2 (17-477, His-tag)

YARS2 Human Purified > 85 % by SDS - PAGE E. coli
20 µg / €300.00
  Acris Antibodies GmbH

YARS2

YARS2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

YARS2

YARS2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for YARS2 (2 products)

Catalog No. Species Pres. Purity   Source  

YARS2 293T Cell Transient Overexpression Lysate(Denatured)

YARS2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

YARS2 overexpression lysate

YARS2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn