NBP1-89876 YBEY antibody

See related secondary antibodies

Search for all "YBEY"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human YBEY

NBP1-89876

More Views

  • NBP1-89876

Product Description for YBEY

Rabbit anti Human YBEY.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for YBEY

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P58557
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MSLVIRNLQRVIPIRRAPLRSKIEIVRRILGVQKFDLGIICVDNKNIQHINRIYRDRNVPTDVLSFPFHEHLKAGEFP
GeneID:
54059
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 54059

Accessory Products

Proteins and/or Positive Controls

Positive controls for YBEY (1 products)

Catalog No. Species Pres. Purity   Source  

C21orf57 Lysate

Western Blot: YBEY Lysate [NBL1-08387] - [NBL1-08387] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for YBEY. Protein
0.1 mg / €400.00
  Novus Biologicals Inc.
  • LinkedIn