TA333737 YIF1A antibody

Rabbit Polyclonal Anti-YIF1A Antibody

See related secondary antibodies

Search for all "YIF1A"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat YIF1A

Product Description for YIF1A

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat YIF1A.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for YIF1A

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms 54TM, 54TMp, HYIF1P, YIF1, YIP1-interacting factor homolog A
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-YIF1A Antibody is: synthetic peptide directed towards the N-terminal region of Human YIF1A. Synthetic peptide located within the following region: LFDDTSGGYSSQPGGYPATGADVAFSVNHLLGDPMANVAMAYGSSIASHG.
Application WB
Background YIF1A has a possible role in transport between endoplasmic reticulum and Golgi.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for YIF1A (2 products)

Catalog No. Species Pres. Purity   Source  


YIF1A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


YIF1A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for YIF1A (1 products)

Catalog No. Species Pres. Purity   Source  

YIF1A Lysate

Western Blot: YIF1A Lysate [NBL1-17929] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for YIF1A
  Novus Biologicals Inc.
  • LinkedIn