H00374887-B01P YJEFN3 antibody

See related secondary antibodies

Search for all "YJEFN3"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human YJEFN3

H00374887-B01P

Product Description for YJEFN3

Mouse anti Human YJEFN3.
Product is tested for Western blot / Immunoblot.

Properties for YJEFN3

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ44968, MGC138490
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
A6XGL0
Immunogen:
YJEFN3 (AAI48457.1, 1 a.a. ~ 299 a.a) full-length human protein.
AA Sequence:
MSSAAGPDPSEAPEERHFLRALELQPPLADMGRAELSSNATTSLVQRRKQAWGRQSWLEQIWNAGPVCQSTAEAAA LERELLEDYRFGRQQLVELCGHASAVAVTKAFPLPALSRKQRTVLVVCGPEQNGAVGLVCARHLRVFEYEPTIFYP TRSLDLLHRDLTTQCEKMDIPFLSYLPTEVQLINEAYGLVVDAVLGPGVEPGEVGGPCTRALATLKLLSIPLVSLD IPSGWDAETGSDSEDGLRPDVLVSLAAPKRCAGRFSGRHHFVAGRFVPDDVRRKFALRLPGYTGTDCVAAL
GeneID:
374887
Add. information Mouse polyclonal antibody raised against a full-length human YJEFN3 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Proteins for YJEFN3 (1 products)

Catalog No. Species Pres. Purity   Source  

YjeF N-terminal domain containing 3 (YJEFN3), transcript variant 2 (transcript variant 2)

YjeF N-terminal domain containing 3 (YJEFN3), transcript variant 2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

Positive controls for YJEFN3 (1 products)

Catalog No. Species Pres. Purity   Source  

YJEFN3 overexpression lysate

YJEFN3 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn