TA333445 ZADH2 antibody

Rabbit Polyclonal Anti-ZADH2 Antibody

See related secondary antibodies

Search for all "ZADH2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZADH2

Product Description for ZADH2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZADH2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZADH2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc-binding alcohol dehydrogenase domain-containing protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for Anti-ZADH2 Antibody: synthetic peptide directed towards the N terminal of human ZADH2. Synthetic peptide located within the following region: FVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQA.
Application WB
Background The specific function of this protein remains unknown.
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ZADH2 (3 products)

Catalog No. Species Pres. Purity   Source  


ZADH2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

ZADH2 (33-377, His-tag)

ZADH2 Human Purified > 90 % by SDS - PAGE E. coli
0.1 mg / €730.00
  OriGene Technologies GmbH

ZADH2 (33-377, His-tag)

ZADH2 Human Purified > 90 % by SDS - PAGE E. coli
20 µg / €300.00
  OriGene Technologies GmbH

Positive controls for ZADH2 (1 products)

Catalog No. Species Pres. Purity   Source  

ZADH2 Lysate

Western Blot: ZADH2 Lysate [NBL1-17955] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZADH2
  Novus Biologicals Inc.
  • LinkedIn