discontinued

H00027033-B02P ZBTB32 / FAZF antibody

See related secondary antibodies

Search for all "ZBTB32 / FAZF"

Quick Overview

Mouse anti Human ZBTB32 / FAZF

H00027033-B02P

More Views

  • H00027033-B02P
  • H00027033-B02P

Product Description for ZBTB32 / FAZF

Mouse anti Human ZBTB32 / FAZF.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for ZBTB32 / FAZF

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms FANCC-interacting protein, Fanconi anemia zinc finger protein, TZFP, Testis zinc finger protein, ZNF538, Zinc finger and BTB domain-containing protein 32
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9Y2Y4
Immunogen:
ZBTB32 (AAH17700.1, 1 a.a. ~ 302 a.a) full-length human protein.
AA Sequence:
MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLN FVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPE QVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRK LPGPLPPAGSLQTSVTPRPSWAEAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRRTCNLCGS
GeneID:
27033
Remarks:
Gene Accession: BC017700.2
Add. information Mouse polyclonal antibody raised against a full-length human ZBTB32 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 27033

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZBTB32 / FAZF (3 products)

Catalog No. Species Pres. Purity   Source  

TZFP 293T Cell Transient Overexpression Lysate(Denatured)

TZFP 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZBTB32 293T Cell Transient Overexpression Lysate(Denatured)

ZBTB32 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZBTB32 overexpression lysate

ZBTB32 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn