discontinued

H00221504-B01 ZBTB9 antibody

See related secondary antibodies

Search for all "ZBTB9"

Quick Overview

Mouse anti Human ZBTB9

H00221504-B01

More Views

  • H00221504-B01

Product Description for ZBTB9

Mouse anti Human ZBTB9.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot, Paraffin Sections.

Properties for ZBTB9

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Zinc finger and BTB domain-containing protein 9
Presentation Serum
Reactivity Hu
Applications E(detection), P, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96C00
Immunogen:
ZBTB9 (NP_689948.1, 1 a.a. ~ 473 a.a) full-length human protein.
AA Sequence:
METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDVSLLVQGRELRAHKAVLAAASPYFHDK LLLGDAPRLTLPSVIEADAFEGLLQLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISARG GNSYHALLSTTSSTGGWCIRSSPFQTPVQSSASTESPASTESPVGGEGSELGEVLQIQVEEEEEEEEDDDDEDQGS ATLSQTPQPQRVSGVFPRPHGPHPLPMTATPRKLPEGESAPLELPAPPALPPKIFYIKQEPFEPKEEISGSGTQPG GAKEETKVFSGGDTEGNGELGFLLPSGPGPTSGGGGPSWKPVDLHGNEILSGGGGPGGAGQAVHGPVKLGGTPPAD GKRFGCLCGKRFAVKPKRDRHIMLTFSLRPFGCGICNKRFKLKHHLTEHMKTHAGALHACPHCGRRFRVHACFLRH RDLCKGQGWATAHWTYK
GeneID:
221504
Remarks:
Gene Accession: NM_152735.3
Add. information Mouse polyclonal antibody raised against a full-length human ZBTB9 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IHC-P,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 221504

Accessory Products

Proteins and/or Positive Controls

Proteins for ZBTB9 (2 products)

Catalog No. Species Pres. Purity   Source  

ZBTB9

ZBTB9 Human Purified
  Abnova Taiwan Corp.

ZBTB9

ZBTB9 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZBTB9 (3 products)

Catalog No. Species Pres. Purity   Source  

ZBTB9 293T Cell Transient Overexpression Lysate(Denatured)

ZBTB9 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZBTB9 overexpression lysate

ZBTB9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Zinc finger and BTB domain-containing protein 9 Lysate

Western Blot: Zinc finger and BTB domain-containing protein 9 Lysate [NBL1-17980] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZBTB9
  Novus Biologicals Inc.
  • LinkedIn