TA345562 ZBTB9 antibody

Rabbit Polyclonal Anti-ZBTB9 Antibody

See related secondary antibodies

Search for all "ZBTB9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZBTB9


More Views

  • TA345562

Product Description for ZBTB9

Rabbit anti Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZBTB9.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZBTB9

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Zinc finger and BTB domain-containing protein 9
Presentation Purified
Reactivity Bov, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ZBTB9 antibody: synthetic peptide directed towards the N terminal of human ZBTB9. Synthetic peptide located within the following region: METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDV.
Application WB
Background ZBTB9 contains 1 BTB (POZ) domain and 2 C2H2-type zinc fingers. It may be involved in transcriptiol regulation.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ZBTB9 (2 products)

Catalog No. Species Pres. Purity   Source  


ZBTB9 Human Purified
  Abnova Taiwan Corp.


ZBTB9 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZBTB9 (3 products)

Catalog No. Species Pres. Purity   Source  

ZBTB9 293T Cell Transient Overexpression Lysate(Denatured)

ZBTB9 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZBTB9 overexpression lysate

ZBTB9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

Zinc finger and BTB domain-containing protein 9 Lysate

Western Blot: Zinc finger and BTB domain-containing protein 9 Lysate [NBL1-17980] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZBTB9
  Novus Biologicals Inc.
  • LinkedIn