discontinued

H00029066-B01 ZC3H7A antibody

See related secondary antibodies

Search for all "ZC3H7A"

Quick Overview

Mouse anti Human ZC3H7A

Product Description for ZC3H7A

Mouse anti Human ZC3H7A.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for ZC3H7A

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms HSPC055, ZC3H7, ZC3HDC7, Zinc finger CCCH domain-containing protein 7A
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8IWR0
Immunogen:
ZC3H7A (AAH12575, 1 a.a. ~ 167 a.a) full-length human protein.
AA Sequence:
MKENGIQDMEQFYELWLKSQKNEKSEDIASQSNKENGKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEK HKEKVFHTEDDQYCWQHRFPTGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPN DNDFGKYSFLFKDLN
GeneID:
29066
Remarks:
Gene Accession: BC012575
Add. information Mouse polyclonal antibody raised against a full-length human ZC3H7A protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 29066

Accessory Products

Proteins and/or Positive Controls

Proteins for ZC3H7A (2 products)

Catalog No. Species Pres. Purity   Source  

ZC3H7A

ZC3H7A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZC3H7A

ZC3H7A Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZC3H7A (1 products)

Catalog No. Species Pres. Purity   Source  

ZC3H7A 293T Cell Transient Overexpression Lysate(Denatured)

ZC3H7A 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn