TA335278 ZDHHC13 antibody

Rabbit Polyclonal Anti-ZDHHC13 Antibody

See related secondary antibodies

Search for all "ZDHHC13"

0.1 mg / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZDHHC13


More Views

  • TA335278

Product Description for ZDHHC13

Rabbit anti Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZDHHC13.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZDHHC13

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms DHHC-13, HIP14L, HIP3RP, Huntingtin-interacting protein 14-related protein, Huntingtin-interacting protein HIP3RP, Probable palmitoyltransferase ZDHHC13, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DHHC domain-containing protein 13
Presentation Purified
Reactivity Can, Eq, GP, Hu, Ms, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ZDHHC13 antibody: synthetic peptide directed towards the N terminal of human ZDHHC13. Synthetic peptide located within the following region: MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV.
Application WB
Background ZDHHC13 may be involved in the NF-kappa-B sigling pathway.
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn