NBP1-60100 ZDHHC19 antibody

See related secondary antibodies

Search for all "ZDHHC19"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZDHHC19

Product Description for ZDHHC19

Rabbit anti Human ZDHHC19.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZDHHC19

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B3KVI1
Immunogen:
Synthetic peptides corresponding to ZDHHC19(zinc finger, DHHC-type containing 19) The peptide sequence was selected from the middle region of ZDHHC19. Peptide sequence AAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFDQGCASNWYLT.
Background ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. The exact function of ZDHHC19 remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified

Accessory Products

  • LinkedIn