NBP1-57049 ZDHHC21 antibody

See related secondary antibodies

Search for all "ZDHHC21"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZDHHC21

Product Description for ZDHHC21

Rabbit anti Human ZDHHC21.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZDHHC21

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5RB84
Immunogen:
Synthetic peptides corresponding to ZDHHC21 (zinc finger, DHHC-type containing 21) The peptide sequence was selected from the middle region of ZDHHC21. Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV.
GeneID:
100172477
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 100172477

Accessory Products

  • LinkedIn