discontinued

NBP1-57049 ZDHHC21 antibody

See related secondary antibodies

Search for all "ZDHHC21"

50 µg / €440.00

Quick Overview

Rabbit anti Human ZDHHC21

Product Description for ZDHHC21

Rabbit anti Human ZDHHC21.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZDHHC21

Product Category Primary Antibodies
Quantity 50 µg
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5RB84
Immunogen:
Synthetic peptides corresponding to ZDHHC21 (zinc finger, DHHC-type containing 21) The peptide sequence was selected from the middle region of ZDHHC21. Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV.
GeneID:
100172477
Background The function of this protein remains unknown.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 100172477

Accessory Products

  • LinkedIn