discontinued

H00023619-B01 ZIM2 antibody

See related secondary antibodies

Search for all "ZIM2"

Quick Overview

Mouse anti Human ZIM2

H00023619-B01

More Views

  • H00023619-B01

Product Description for ZIM2

Mouse anti Human ZIM2.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for ZIM2

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Zinc finger imprinted 2
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NZV7
Immunogen:
ZIM2 (NP_056178.3, 1 a.a. ~ 527 a.a) full-length human protein.
AA Sequence:
MYQPEDDNNSDVTSDDDMTRNRRESSPPHSVHSFSGDRDWDRRGRSRDMEPRDRWSHTRNPRSRMPPRDLSLPVVA KTSFEMDREDDRDSRAYESRSQDAESYQNVVDLAEDRKPHNTIQDNMENYRKLLSLGFLAQDSVPAEKRNTEMLDN LPSAGSQFPDFKHLGTFLVFEELVTFEDVLVDFSPEELSSLSAAQRNLYREVMLENYRNLVSLGHQFSKPDIISRL EEEESYAMETDSRHTVICQGESHDDPLEPHQGNQEKLLTPITMNDPKTLTPERSYGSDEFERSSNLSKQSKDPLGK DPQEGTAPGICTSPQSASQENKHNRCEFCKRTFSTQVALRRHERIHTGKKPYECKQCAEAFYLMPHLNRHQKTHSG RKTSGCNEGRKPSVQCANLCERVRIHSQEDYFECFQCGKAFLQNVHLLQHLKAHEAARVLPPGLSHSKTYLIRYQR KHDYVGERACQCCDCGRVFSRNSYLIQHYRTHTQERPYQCQLCGKCFGRPSYLTQHYQLHSQEKTVECDHC
GeneID:
23619
Remarks:
Gene Accession: NM_015363.3
Add. information Mouse polyclonal antibody raised against a full-length human ZIM2 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 23619

Accessory Products

Proteins and/or Positive Controls

Proteins for ZIM2 (3 products)

Catalog No. Species Pres. Purity   Source  

ZIM2 (N-term HIS tag, transcript variant 1)

ZIM2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

ZIM2

ZIM2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZIM2

ZIM2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZIM2 (2 products)

Catalog No. Species Pres. Purity   Source  

ZIM2 293T Cell Transient Overexpression Lysate(Denatured)

ZIM2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZIM2 Lysate

Western Blot: ZIM2 Lysate [NBL1-18035] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZIM2
  Novus Biologicals Inc.
  • LinkedIn