NBP1-69317 Zinc transporter ZIP11 / SLC39A11 antibody

See related secondary antibodies

Search for all "Zinc transporter ZIP11 / SLC39A11"

50 µg / €440.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat Zinc transporter ZIP11 / SLC39A11

Product Description for Zinc transporter ZIP11 / SLC39A11

Rabbit anti Human, Mouse, Rat Zinc transporter ZIP11 / SLC39A11.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Zinc transporter ZIP11 / SLC39A11

Product Category Primary Antibodies
Quantity 50 µg
Synonyms C17orf26, Solute carrier family 39 member 11, ZIP-11, ZIP11, Zrt-and Irt-like protein 11
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
B2R8H7
Immunogen:
Synthetic peptides corresponding to SLC39A11(solute carrier family 39 (metal ion transporter), member 11) The peptide sequence was selected from the middle region of SLC39A11. Peptide sequence GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARN
GeneID:
201266
Background SLC39A11 belongs to the ZIP transporter (TC 2.A.5) family. It is a multi-pass membrane protein. SLC39A11 may act as a zinc-influx transporter.
Storage Store at -20C. Avoid freeze-thaw cycles.
Format
Purification:
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
State:
Aff - Purified
Gene ID 201266

Accessory Products

  • LinkedIn