NBP1-69317 Zinc transporter ZIP11 / SLC39A11 antibody

See related secondary antibodies

Search for all "Zinc transporter ZIP11 / SLC39A11"

Quick Overview

Rabbit anti Human, Mouse, Rat Zinc transporter ZIP11 / SLC39A11

Product Description for Zinc transporter ZIP11 / SLC39A11

Rabbit anti Human, Mouse, Rat Zinc transporter ZIP11 / SLC39A11.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Zinc transporter ZIP11 / SLC39A11

Product Category Primary Antibodies
Quantity 50 µg
Synonyms C17orf26, Solute carrier family 39 member 11, ZIP-11, ZIP11, Zrt-and Irt-like protein 11
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe only
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Swiss Prot Num:
Synthetic peptides corresponding to SLC39A11(solute carrier family 39 (metal ion transporter), member 11) The peptide sequence was selected from the middle region of SLC39A11. Peptide sequence GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARN
Background SLC39A11 belongs to the ZIP transporter (TC 2.A.5) family. It is a multi-pass membrane protein. SLC39A11 may act as a zinc-influx transporter.
Storage Store at -20C. Avoid freeze-thaw cycles.
Peptide affinity purified
Buffer System:
This product is lyophilized and contains PBS and 2% Sucrose. Add 50 ul of distilled water. Final antibody concentration is 1 mg/ml.
Aff - Purified
Gene ID 201266

Accessory Products

  • LinkedIn