TA342455 ZNF117 antibody

Rabbit Polyclonal Anti-ZNF117 Antibody

See related secondary antibodies

Search for all "ZNF117"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF117

TA342455

More Views

  • TA342455
  • TA342455

Product Description for ZNF117

Rabbit anti Human ZNF117.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF117

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein 117
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q03924
Immunogen:
The immunogen for anti-ZNF117 antibody: synthetic peptide directed towards the N terminal of human ZNF117. Synthetic peptide located within the following region: QCLKTTLSKIFQCNKYVEVFHKISNSNRHKMRHTENKHFKCKECRKTFCM.
GeneID:
51351
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 202% sucrose.
State:
Purified

Accessory Products

  • LinkedIn