discontinued

H00007690-B01P ZNF131 antibody

See related secondary antibodies

Search for all "ZNF131"

Quick Overview

Mouse anti Human, Rat ZNF131

H00007690-B01P

More Views

  • H00007690-B01P
  • H00007690-B01P

Product Description for ZNF131

Mouse anti Human, Rat ZNF131.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for ZNF131

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein 131
Presentation Purified
Reactivity Hu, Rt
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P52739
Immunogen:
ZNF131 (AAH35875.1, 1 a.a. ~ 510 a.a) full-length human protein.
AA Sequence:
MAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVIT ESLPSAESEPVEIEVEIAEGTIEVEDEGIETLEEVASAKQSVKYIQSTGSSDDSALALLADITSKYRQGDRKGQIK EDGCPSDPTSKQEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFG HFKEHLRKHTGEKPFECPNCHERFARNSTLKCHLTACQTGVGAKKGRKKLYECQVCNSVFNSWDQFKDHLVIHTGD KPNHCTLCDLWFMQGNELRRHLSDAHNISERLVTEEVLSVETRVQTEPVTSMTIIEQVGKVHVLPLLQVQVDSAQV TVEQVHPDLLQDSQVHDSHMSELPEQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEVQTELLEADLDHVTP EIMNQEERESSQADAAEAAREDHEDAEDLETKPTVDSEAEKAENEDRTALPVLE
GeneID:
7690
Remarks:
Gene Accession: BC035875.2
Add. information Mouse polyclonal antibody raised against a full-length human ZNF131 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ti,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human,Rat
Gene ID 7690

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF131 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF131

ZNF131 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF131

ZNF131 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF131 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF131 293T Cell Transient Overexpression Lysate(Denatured)

ZNF131 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn