discontinued

H00007690-D01 ZNF131 antibody

See related secondary antibodies

Search for all "ZNF131"

Quick Overview

Rabbit anti Human ZNF131

Product Description for ZNF131

Rabbit anti Human ZNF131.
Presentation: Serum
Product is tested for ELISA (detection), Immunoprecipitation.

Properties for ZNF131

Product Category Primary Antibodies
Target Category
Quantity 0.1 ml
Synonyms Zinc finger protein 131
Presentation Serum
Reactivity Hu
Applications E(detection), IP
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P52739
Immunogen:
ZNF131 (AAH35875.1, 1 a.a. ~ 510 a.a) full-length human protein.
AA Sequence:
MAFRHLIEFTYTAKLMIQGEEEANDVWKAAEFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVIT ESLPSAESEPVEIEVEIAEGTIEVEDEGIETLEEVASAKQSVKYIQSTGSSDDSALALLADITSKYRQGDRKGQIK EDGCPSDPTSKQEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFG HFKEHLRKHTGEKPFECPNCHERFARNSTLKCHLTACQTGVGAKKGRKKLYECQVCNSVFNSWDQFKDHLVIHTGD KPNHCTLCDLWFMQGNELRRHLSDAHNISERLVTEEVLSVETRVQTEPVTSMTIIEQVGKVHVLPLLQVQVDSAQV TVEQVHPDLLQDSQVHDSHMSELPEQVQVSYLEVGRIQTEEGTEVHVEELHVERVNQMPVEVQTELLEADLDHVTP EIMNQEERESSQADAAEAAREDHEDAEDLETKPTVDSEAEKAENEDRTALPVLE
GeneID:
7690
Remarks:
Gene Accession: BC035875.2
Add. information Rabbit polyclonal antibody raised against a full-length human ZNF131 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IP
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 7690

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF131 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF131

ZNF131 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF131

ZNF131 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF131 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF131 293T Cell Transient Overexpression Lysate(Denatured)

ZNF131 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn