discontinued

H00007690-M07 ZNF131 antibody

See related secondary antibodies

Search for all "ZNF131"

Quick Overview

Mouse anti Human ZNF131 5F1

Product Description for ZNF131

Mouse anti Human ZNF131 5F1.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for ZNF131

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein 131
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 5F1
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P52739
Immunogen:
ZNF131 (AAH35875, 139 a.a. ~ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
TSKYRQGDRKGQIKEDGCPSDPTSKQEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKI HVCQYCEKQFDHFGHFKEHLRKHT*
GeneID:
7690
Remarks:
Gene Accession: BC035875
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant ZNF131.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 7690

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF131 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF131

ZNF131 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF131

ZNF131 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF131 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF131 293T Cell Transient Overexpression Lysate(Denatured)

ZNF131 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn