TA342427 ZNF131 antibody

Rabbit Polyclonal Anti-ZNF131 Antibody

See related secondary antibodies

Search for all "ZNF131"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat ZNF131

TA342427

More Views

  • TA342427
  • TA342427

Product Description for ZNF131

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat ZNF131.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF131

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein 131
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P52739
Immunogen:
The immunogen for anti-ZNF131 antibody: synthetic peptide directed towards the N terminal of human ZNF131. Synthetic peptide located within the following region: EFLQMLEAIKALEVRNKENSAPLEENTTGKNEAKKRKIAETSNVITESLP.
GeneID:
7690
Application WB
Background ZNF131 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 BTB (POZ) domain and 6 C2H2-type zinc fingers. It may be involved in transcriptiol regulation. ZNF131 plays a role during development and organogenesis as well as in the function of the adult central nervous system.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 174% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF131 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF131

ZNF131 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF131

ZNF131 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF131 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF131 293T Cell Transient Overexpression Lysate(Denatured)

ZNF131 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn