TA343647 ZNF16 antibody

Rabbit Polyclonal Anti-ZNF16 Antibody

See related secondary antibodies

Search for all "ZNF16"

50 µg / €325.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Porcine ZNF16

TA343647

More Views

  • TA343647

Product Description for ZNF16

Rabbit anti Human, Mouse, Porcine ZNF16.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZNF16

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KOX9, Zinc finger protein 16, Zinc finger protein KOX9
Presentation Purified
Reactivity Hu, Ms, Por
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P17020
Immunogen:
The immunogen for anti-ZNF16 antibody: synthetic peptide directed towards the N terminal of human ZNF16. Synthetic peptide located within the following region: MPSLRTRREEAEMELSVPGPSPWTPAAQARVRDAPAVTHPGSAACGTPCC.
GeneID:
7564
Application WB
IHC
Background ZNF16 contains a C2H2 type of zinc finger, and thus may function as a transcription factor.The protein encoded by this gene contains a C2H2 type of zinc finger, and thus may function as a transcription factor. This gene is located in a region close to ZNF7/KOX4, a gene also encoding a zinc finger protein, on chromosome 8. Two altertively spliced variants, encoding the same protein, have been identified.
Format
Purification:
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF16 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF16

ZNF16 Human Purified
  Abnova Taiwan Corp.

ZNF16

ZNF16 Human Purified
  Abnova Taiwan Corp.

ZNF16

ZNF16 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF16

ZNF16 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF16 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF16 293T Cell Transient Overexpression Lysate(Denatured)

ZNF16 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF16 Lysate

Western Blot: ZNF16 Lysate [NBL1-18065] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF16
  Novus Biologicals Inc.

ZNF16 overexpression lysate

ZNF16 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.

ZNF16 overexpression lysate

ZNF16 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn