TA339525 ZNF248 antibody

Rabbit Polyclonal Anti-ZNF248 Antibody

See related secondary antibodies

Search for all "ZNF248"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZNF248

Product Description for ZNF248

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ZNF248.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF248

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein 248
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ZNF248 antibody: synthetic peptide directed towards the N terminal of human ZNF248. Synthetic peptide located within the following region: CEMNLKNISGLIISKKNCSRKKPDEFNVCEKLLLDIRHEKIPIGEKSYKY.
Application WB
Background May be involved in transcriptiol regulation.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn