discontinued

H00010127-M05 ZNF263 antibody

See related secondary antibodies

Search for all "ZNF263"

Quick Overview

Mouse anti Human ZNF263 2G6

Product Description for ZNF263

Mouse anti Human ZNF263 2G6.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for ZNF263

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms FPM315, ZKSCAN12, Zinc finger protein 263, Zinc finger protein FPM315, Zinc finger protein with KRAB and SCAN domains 12
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 2G6
Host Mouse
Isotype IgG1
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
O14978
Immunogen:
ZNF263 (NP_005732, 201 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
PEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRALSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKL WDPSVQSCKEGLSPRGPAPGEE*
GeneID:
10127
Remarks:
Gene Accession: NM_005741
Isotype control AM03095PU-N, SM10P (for use in human samples)
Add. information Mouse monoclonal antibody raised against a partial recombinant ZNF263.

Antibody Reactive Against Recombinant Protein.
Application ELISA,S-ELISA,WB-Ce,WB-Re
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10127

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF263 (8 products)

Catalog No. Species Pres. Purity   Source  

ZNF263

ZNF263 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human Purified
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF263

ZNF263 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF263 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF263 293T Cell Transient Overexpression Lysate(Denatured)

ZNF263 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn