discontinued

H00010781-M02 ZNF266 antibody

See related secondary antibodies

Search for all "ZNF266"

Quick Overview

Mouse anti Human ZNF266 4G5

Product Description for ZNF266

Mouse anti Human ZNF266 4G5.
Presentation: Purified
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for ZNF266

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms HZF1, KIAA2007, Zinc finger protein 266
Presentation Purified
Reactivity Hu
Applications E, WB
Clonality Monoclonal
Clone 4G5
Host Mouse
Isotype IgG2a
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14584
Immunogen:
ZNF266 (NP_006622, 274 a.a. ~ 347 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
AA Sequence:
GRAFTVSSCLSQHMKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIH*
GeneID:
10781
Remarks:
Gene Accession: NM_006631
Isotype control AM03096PU-N
Add. information Mouse monoclonal antibody raised against a partial recombinant ZNF266.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 10781

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF266 (5 products)

Catalog No. Species Pres. Purity   Source  

ZNF266 (full length, N-term HIS tag)

ZNF266 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

ZNF266

ZNF266 Human Purified
  Abnova Taiwan Corp.

ZNF266

ZNF266 Human Purified
  Abnova Taiwan Corp.

ZNF266

ZNF266 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF266

ZNF266 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF266 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF266 293T Cell Transient Overexpression Lysate(Denatured)

ZNF266 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn