discontinued

AP42003PU-N ZNF341 antibody

See related secondary antibodies

Search for all "ZNF341"

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse ZNF341

AP42003PU-N

More Views

  • AP42003PU-N

Product Description for ZNF341

Rabbit anti Bovine, Canine, Human, Mouse ZNF341.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZNF341

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein 341
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Acris Antibodies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BYN7
Immunogen:
The immunogen for anti-ZNF341 antibody: synthetic peptide of the middle region of human ZNF341
AA Sequence:
GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC
GeneID:
84905
Application Western blotting (0.2 - 1 µg/ml)
Immunohistochemistry on paraffin embedded sections (2-8 µg/ml)
Background ZNF341 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 12 C2H2-type zinc fingers. Zinc Finger Protein 341 is a new candidate transcription factor.
General Readings Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Storage Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format
Purification:
Purified on peptide immunoaffinity column
State:
Lyophilised from PBS
Aff - Purified
Reconstitution:
Add 50 μl of distilled water
Species Reactivity
Species reactivity (expected):
Mouse, Bovine, Dog
Species reactivity (tested):
Human
Gene ID 84905

Accessory Products

  • LinkedIn