TA329642 ZNF341 antibody

Rabbit Polyclonal anti-ZNF341 antibody

See related secondary antibodies

Search for all "ZNF341"

0.1 mg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF341

Product Description for ZNF341

Rabbit anti Human ZNF341.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF341

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Zinc finger protein 341
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ZNF341 antibody: synthetic peptide directed towards the N terminal of human ZNF341. Synthetic peptide located within the following region: EGMDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLDDEDVFLCGKCK.
Application WB
Background Zinc Finger Protein 341 is a new candidate transcription factor.
Buffer System:
Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

  • LinkedIn