discontinued

H00079175-B01 ZNF343 antibody

See related secondary antibodies

Search for all "ZNF343"

Quick Overview

Mouse anti Human ZNF343

H00079175-B01

More Views

  • H00079175-B01

Product Description for ZNF343

Mouse anti Human ZNF343.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for ZNF343

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Zinc finger protein 343
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P1L6
Immunogen:
ZNF343 (ENSP00000370652, 1 a.a. ~ 118 a.a) full-length human protein.
AA Sequence:
MMLPYPSALGDQYWEEILLPKNGENVETMKKLTQNHKAKGLPSNDTDCPQKKEGKAQIVVPVTFRDVTVIFTEAEW KRLSPEQRNLYKEVMLENYRNLLSLGQEIETILANIVKSHLY
GeneID:
79175
Remarks:
Gene Accession: ENST00000202629
Add. information Mouse polyclonal antibody raised against a full-length human ZNF343 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 79175

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF343 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF343

ZNF343 Human Purified
  Abnova Taiwan Corp.

ZNF343

ZNF343 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF343

ZNF343 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF343 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF343 293T Cell Transient Overexpression Lysate(Denatured)

ZNF343 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn