TA330230 ZNF409 / ZFHX2 antibody

Rabbit Polyclonal Anti-ZNF409 Antibody

See related secondary antibodies

Search for all "ZNF409 / ZFHX2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat ZNF409 / ZFHX2

TA330230

More Views

  • TA330230

Product Description for ZNF409 / ZFHX2

Rabbit anti Bovine, Canine, Human, Mouse, Rat ZNF409 / ZFHX2.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZNF409 / ZFHX2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KIAA1056, KIAA1762, ZFH2, Zinc finger homeobox protein 2, Zinc finger homeodomain protein 2, Zinc finger protein 409
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9C0A1
Immunogen:
The immunogen for anti-ZNF409 antibody: synthetic peptide directed towards the middle region of human ZNF409
AA Sequence:
GGQGSPPEASLPPSAGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEKH
GeneID:
85446
Application

Western blotting (0.2 - 1 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)

Background ZNF409 also know as ZFHX2 is a 2572 amino acid protein containing 13 C2H2-type zinc fingers and 3 homeobox DNA-binding domains. There are 2 isoforms reported. Isoform 2 misses aa 863-2527 resulting in a reduced molecular mass of 92 kDA.
Storage Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term. Avoid repeated freezing and thawing. Shelf life: one year from dispatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Lyophilized from PBS
Aff - Purified
Reconstitution:
Add 50 μl of distilled water to a final concentration of 1 mg/ml.
Species Reactivity
Species reactivity (expected):
Dog, Mouse, Rat, Bovine
Species reactivity (tested):
Human
Specificity
Specificity:
Will detect both isoforms of ZNF409 / ZFHX2

Accessory Products

  • LinkedIn