discontinued

H00158399-B01P ZNF483 antibody

See related secondary antibodies

Search for all "ZNF483"

Quick Overview

Mouse anti Human ZNF483

H00158399-B01P

More Views

  • H00158399-B01P
  • H00158399-B01P

Product Description for ZNF483

Mouse anti Human ZNF483.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot, Paraffin Sections.

Properties for ZNF483

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms KIAA1962, ZKSCAN16, Zinc finger protein 483, Zinc finger protein with KRAB and SCAN domains 16
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, P, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TF39
Immunogen:
ZNF483 (AAH65738.1, 1 a.a. ~ 244 a.a) full-length human protein.
AA Sequence:
MQAVVPLNKMTAISPEPQTLASTEQNEVPRVVTSGEQEAILRGNAADAESFRQRFRWFCYSEVAGPRKALSQLWEL CNQWLRPDIHTKEQILELLVFEQFLTILPGEIRIWVKSQHPESSEEVVTLIEDLTQMLEEKDPVSQDSTVSQEENS KEDKMVTVCPNTESCESITLKDVAVNFSRGEWKKLEPFQKELYKEVLLENLRNLEFLDFPVSKLELISQLKWVELP WLLEEVSKSSRLGSVI
GeneID:
158399
Remarks:
Gene Accession: BC065738.1
Add. information Mouse polyclonal antibody raised against a full-length human ZNF483 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,IHC-P,WB-Tr
Storage In 1x PBS, pH 7.2
Format
Label:
None
Purification:
Purified
Buffer System:
In 1x PBS, pH 7.2
Purity:
Purified
State:
Purified
Specificity
Species:
Human
Gene ID 158399

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF483 (5 products)

Catalog No. Species Pres. Purity   Source  

ZNF483 (transcript variant 2)

ZNF483 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €438.00
  OriGene Technologies, Inc.

ZNF483

ZNF483 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF483

ZNF483 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF483

ZNF483 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF483

ZNF483 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF483 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF483 293T Cell Transient Overexpression Lysate(Denatured)

ZNF483 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF483 overexpression lysate

ZNF483 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn