discontinued

H00220992-B01 ZNF485 antibody

See related secondary antibodies

Search for all "ZNF485"

Quick Overview

Mouse anti Human ZNF485

Product Description for ZNF485

Mouse anti Human ZNF485.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for ZNF485

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Zinc finger protein 485
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8NCK3
Immunogen:
ZNF485 (NP_660355, 1 a.a. ~ 402 a.a) full-length human protein.
AA Sequence:
MLENYGNLVSVGLLSSKPKLITQLEQGAEPWTEVREAPSGTHAVEDYWFETKMSALKQSTSEASVLGERTKSVMME KGLDWEGRSSTEKNYKCKECGKVFKYNSSFISHQRNHTSEKPHKCKECGIAFMNSSSLLNHHKVHAGKQPYRCIEC GKFLKKHSTFINHQRIHSREKPHKCIECGKTFRKNSILLSHQRIHTGQKPYKCNDCGKAFAQNAALTRHERIHSGE KPFKCNKCGRAFRDNSTVLEHQKIHTGEKPYQCNECGKAFRKSSTLISHQRMHTGEKPYHCSKCGKSFRYSSSFAG HQKTHSGNKPYQCRDCGKAFTKSSTLTGHQRIHTGEKPYHCKKCGKAFRHSSGLVEHQRLHTGEKPYKCNECGKAF PRSSALKQHKKIHNKERAMKCS
GeneID:
220992
Remarks:
Gene Accession: NM_145312
Add. information Mouse polyclonal antibody raised against a full-length human ZNF485 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 220992

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF485 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF485

ZNF485 Human Purified
  Abnova Taiwan Corp.

ZNF485

ZNF485 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZNF485 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF485 293T Cell Transient Overexpression Lysate(Denatured)

ZNF485 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF485 Lysate

Western Blot: ZNF485 Lysate [NBL1-18163] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZNF485.
  Novus Biologicals Inc.
  • LinkedIn