TA341463 ZNF485 antibody

Rabbit Polyclonal Anti-ZNF485 Antibody

See related secondary antibodies

Search for all "ZNF485"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ZNF485

Product Description for ZNF485

Rabbit anti Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat ZNF485.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF485

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein 485
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ZNF485 antibody: synthetic peptide directed towards the C terminal of human ZNF485. Synthetic peptide located within the following region: SSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHNKERAMKCS.
Application WB
Background May be involved in transcriptiol regulation.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF485 (2 products)

Catalog No. Species Pres. Purity   Source  


ZNF485 Human Purified
  Abnova Taiwan Corp.


ZNF485 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZNF485 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF485 293T Cell Transient Overexpression Lysate(Denatured)

ZNF485 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF485 Lysate

Western Blot: ZNF485 Lysate [NBL1-18163] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZNF485.
  Novus Biologicals Inc.
  • LinkedIn