H00125919-B01 ZNF543 MaxPab mouse antibody

See related secondary antibodies

Search for all "ZNF543 MaxPab mouse"

50 µl / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human ZNF543 MaxPab mouse

H00125919-B01

More Views

  • H00125919-B01

Product Description for ZNF543 MaxPab mouse

Mouse anti Human ZNF543 MaxPab mouse.
Presentation: Purified
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for ZNF543 MaxPab mouse

Product Category Primary Antibodies
Quantity 50 µl
Synonyms DKFZp434H055, zinc finger protein 543
Presentation Purified
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Immunogen:
ZNF543 (AAI01014.1, 1 a.a. ~ 600 a.a) full-length human protein.
AA Sequence:
MAASAQVSVTFEDVAVTFTQEEWGQLDAAQRTLYQEVMLETCGLLMSLGCPLFKPELIYQLDHRQELWMATKDLSQ SSYPGDNTKPKTTEPTFSHLALPEEVLLQERLTQGASKNSQLGQSKDQDGPSEMQEVHLKIGIGPQRGKLLEKMSS ERDGLGSDDGVCTKITQKQVSTEGDLYECDSHGPVTDALIREEKNSYKCEECGKVFKKNALLVQHERIHTQVKPYE CTECGKTFSKSTHLLQHHIIHTGEKPYKCMECGKAFNRRSHLTRHQRIHSGEKPYKCSVCGKAFTHRSTFVLHHRS HTGEKPFVCKECGKAFRDRPGFIRHYIIHTGEKPYECIECGKAFNRRSYLTWHQQIHTGVKPFECNECGKAFCESA DLIQHYIIHTGEKPYKCMECGKAFNRRSHLKQHQRIHTGEKPYECSECGKAFTHCSTFVLHKRTHTGEKPYECKEC GKAFSDRADLIRHFSIHTGEKPYECVECGKAFNRSSHLTRHQQIHTGEKPYECIQCGKAFCRSANLIRHSIIHTGE KPYECSECGKAFNRGSSLTHHQRIHTGRNPTIVTDVGRPFMTAQTSVNIQELLLGKEFLNITTEENLW
Remarks:
Gene Accession: BC101013.1
Add. information Mouse polyclonal antibody raised against a full-length human ZNF543 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Purity:
Antibody reactive against mammalian transfected lysate.
State:
Purified
Specificity
Species:
Human

Accessory Products

  • LinkedIn