TA341404 ZNF556 antibody

Rabbit Polyclonal Anti-ZNF556 Antibody

See related secondary antibodies

Search for all "ZNF556"

0.1 mg / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF556

Product Description for ZNF556

Rabbit anti Human ZNF556.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF556

Product Category Primary Antibodies
Target Category
Quantity 0.1 mg
Synonyms Zinc finger protein 556
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ZNF556 antibody: synthetic peptide directed towards the C terminal of human ZNF556. Synthetic peptide located within the following region: KAFGWPSSLHKHARTHAKKKPVSGGSVGKSSARPRPSTDVKSQTREKVYK.
Application WB
Background May be involved in transcriptiol regulation.
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF556 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF556 293T Cell Transient Overexpression Lysate(Denatured)

ZNF556 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF556 overexpression lysate

ZNF556 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn