discontinued

H00079230-B01 ZNF557 antibody

See related secondary antibodies

Search for all "ZNF557"

Quick Overview

Mouse anti Human ZNF557

H00079230-B01

More Views

  • H00079230-B01

Product Description for ZNF557

Mouse anti Human ZNF557.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for ZNF557

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Zinc finger protein 557
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N988
Immunogen:
ZNF557 (AAH03020.1, 1 a.a. ~ 375 a.a) full-length human protein.
AA Sequence:
MAAVVLPPTAALSSLFPASQREGHTEGGELVNELLKSWLKGLVTFEDVAVEFTQEEWALLDPAQRTLYRDVMLENC RNLASLGNQVDKPRLISQLEQEDKVMTEERGILSGTCPDVENPFKAKGLTPKLHVFRKEQSRNMKMERNHLGATLN ECNQCFKVFSTKSSLTRHRKIHTGERPYGCSECGKSYSSRSYLAVHKRIHNGEKPYECNDCGKTFSSRSYLTVHKR IHNGEKPYECSDCGKTFSNSSYLRPHLRIHTGEKPYKCNQCFREFRTQSIFTRHKRVHTGEGHYVCNQCGKAFGTR SSLSSHYSIHTGEYPYECHDCGRTFRRRSNLTQHIRTHTGEKPYTCNECGKSFTNSFSLTIHRRIHNGEKS
GeneID:
79230
Remarks:
Gene Accession: BC003020.1
Add. information Mouse polyclonal antibody raised against a full-length human ZNF557 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 79230

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF557 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF557

ZNF557 Human
  Abnova Taiwan Corp.

ZNF557

ZNF557 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF557

ZNF557 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF557 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF557 293T Cell Transient Overexpression Lysate(Denatured)

ZNF557 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF557 overexpression lysate

ZNF557 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn