TA341456 ZNF570 antibody

Rabbit Polyclonal Anti-ZNF570 Antibody

See related secondary antibodies

Search for all "ZNF570"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF570

Product Description for ZNF570

Rabbit anti Human ZNF570.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF570

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein 570
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96NI8
Immunogen:
The immunogen for anti-ZNF570 antibody: synthetic peptide directed towards the N terminal of human ZNF570. Synthetic peptide located within the following region: QGKAPWMVKRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTS.
GeneID:
148268
Application WB
Background May be involved in transcriptiol regulation.
Format
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn