TA339490 ZNF581 antibody

Rabbit Polyclonal Anti-ZNF581 Antibody

See related secondary antibodies

Search for all "ZNF581"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Human ZNF581

Product Description for ZNF581

Rabbit anti Canine, Human ZNF581.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF581

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein 581
Presentation Purified
Reactivity Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ZNF581 antibody: synthetic peptide directed towards the middle region of human ZNF581. Synthetic peptide located within the following region: QREPGASGAPGQKKCYSCPVCSRVFEYMSYLQRHSITHSEVKPFECDICG.
Application WB
Background May be involved in transcriptiol regulation.
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF581 (5 products)

Catalog No. Species Pres. Purity   Source  


ZNF581 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €748.00

  OriGene Technologies, Inc.


ZNF581 Human Purified
  Abnova Taiwan Corp.


ZNF581 Human Purified
  Abnova Taiwan Corp.


ZNF581 Human Purified 95 % E. coli
  GenWay Biotech Inc.


ZNF581 Human Purified 95 % E. coli
  GenWay Biotech Inc.

Positive controls for ZNF581 (3 products)

Catalog No. Species Pres. Purity   Source  

zinc finger protein 581 Lysate

Western Blot: zinc finger protein 581 Lysate [NBL1-18197] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF581
  Novus Biologicals Inc.

ZNF581 293T Cell Transient Overexpression Lysate(Denatured)

ZNF581 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF581 overexpression lysate

ZNF581 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn