discontinued

H00285268-B01 ZNF621 antibody

See related secondary antibodies

Search for all "ZNF621"

Quick Overview

Mouse anti Human ZNF621

Product Description for ZNF621

Mouse anti Human ZNF621.
Presentation: Serum
Product is tested for ELISA (detection), Western blot / Immunoblot.

Properties for ZNF621

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms Zinc finger protein 621
Presentation Serum
Reactivity Hu
Applications E(detection), WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZSS3
Immunogen:
ZNF621 (NP_940886.1, 1 a.a. ~ 439 a.a) full-length human protein.
AA Sequence:
MLQTTWPQESVTFEDVAVYFTQNQWASLDPAQRALYGEVMLENYANVASLVAFPFPKPALISHLERGEAPWGPDPW DTEILRGISQGGESWIKNEGLVIKQEASEETELHRMPVGGLLRNVSQHFDFKRKALKQTFNLNPNLILRGGMKFYE CKECGKIFRYNSKLIRHQMSHTGEKPFKCKECGKAFKSSYDCIVHEKNHIGEGPYECKECGKGLSSNTALTQHQRI HTGEKPYECKECGKAFRRSAAYLQHQRLHTGEKLYKCKECWKAFGCRSLFIVHQRIHTGEKPYQCKECGKAFTQKI ASIQHQRVHTGEKPYECKVCGKAFKWYGSFVQHQKLHPVEKKPVKVLGPSLVSPQCSSPAIPPVLLQGSCSASAVA VPSLTFPHAVLIPTSGNFFMLLPTSGIPSSSAQIVRVFQGLTPTVKPSPVILTPSSHSS
GeneID:
285268
Remarks:
Gene Accession: NM_198484.2
Add. information Mouse polyclonal antibody raised against a full-length human ZNF621 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 285268

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF621 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF621 (full length, N-term HIS tag, transcript variant 1)

ZNF621 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

ZNF621 (full length, N-term HIS tag, transcript variant 2)

ZNF621 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €199.00
  OriGene Technologies, Inc.

ZNF621

ZNF621 Human Purified
  Abnova Taiwan Corp.

ZNF621

ZNF621 Human Purified
  Abnova Taiwan Corp.

Positive controls for ZNF621 (5 products)

Catalog No. Species Pres. Purity   Source  

ZNF621 293T Cell Transient Overexpression Lysate(Denatured)

ZNF621 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF621 Lysate

Western Blot: ZNF621 Lysate [NBL1-18210] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ZNF621.
  Novus Biologicals Inc.

ZNF621 overexpression lysate

ZNF621 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZNF621 overexpression lysate

ZNF621 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ZNF621 overexpression lysate

ZNF621 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn