discontinued

H00130507-A01 ZNF650 antibody

See related secondary antibodies

Search for all "ZNF650"

Quick Overview

Mouse anti Human ZNF650

Product Description for ZNF650

Mouse anti Human ZNF650.
Presentation: Serum
Product is tested for Enzyme Immunoassay, Western blot / Immunoblot.

Properties for ZNF650

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms E3 ubiquitin-protein ligase UBR3, KIAA2024, N-recognin-3, UBR3, Ubiquitin-protein ligase E3-alpha-3, Ubiquitin-protein ligase E3-alpha-III, Zinc finger protein 650
Presentation Serum
Reactivity Hu
Applications E, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZT12
Immunogen:
ZNF650 (NP_742067, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
AA Sequence:
MNKRIIEEICRKVTPPVPPKKVTAAEKKTLDKEERRQKARERQQKLLAEFASRQKSFMETAMDVDSPENDIPMEIT TAEPQVSEAVYDCVICGQSGPSSEDRPTGLVVLL*
GeneID:
130507
Remarks:
Gene Accession: NM_172070
Add. information Mouse polyclonal antibody raised against a partial recombinant ZNF650.

Antibody Reactive Against Recombinant Protein.
Application ELISA,WB-Re,WB-Ti
Storage 50 % glycerol
Format
Label:
None
Purification:
Serum
Buffer System:
50 % glycerol
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 130507

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF650 (4 products)

Catalog No. Species Pres. Purity   Source  

ZNF650

ZNF650 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

ZNF650

ZNF650 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue
  Abnova Taiwan Corp.

ZNF650

ZNF650 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF650

ZNF650 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ZNF650 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF650 293T Cell Transient Overexpression Lysate(Denatured)

ZNF650 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn