H00079027-B01 ZNF655 antibody

See related secondary antibodies

Search for all "ZNF655"

50 µl / €370.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human ZNF655

H00079027-B01

Product Description for ZNF655

Mouse anti Human ZNF655.
Product is tested for Western blot / Immunoblot.

Properties for ZNF655

Product Category Primary Antibodies
Quantity 50 µl
Synonyms DKFZp686M1631, FLJ23461, MGC10859, MGC16203, MGC5521, VIK, VIK-1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
D6W5T4
Immunogen:
ZNF655 (NP_076966.1, 1 a.a. ~ 181 a.a) full-length human protein.
AA Sequence:
MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGAPPVPQVPALPREGSPGDQAAALLTARYQEF VTFEDVAVHLTREEWGYLDPVQRDLYREVMLENYGNVVSLGILLRLPTTRIHSVNSCPALSHTQASAFSGETLAVL TAGISKRWPKYRLPIDIARPCSETPFPRL
GeneID:
79027
Add. information Mouse polyclonal antibody raised against a full-length human ZNF655 protein.
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
No additive
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

  • LinkedIn