TA339789 ZNF678 antibody

Rabbit Polyclonal Anti-ZNF678 Antibody

See related secondary antibodies

Search for all "ZNF678"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZNF678

Product Description for ZNF678

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ZNF678.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF678

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms Zinc finger protein 678
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q5SXM1
Immunogen:
The immunogen for Anti-ZNF678 antibody is: synthetic peptide directed towards the middle region of Human ZNF678. Synthetic peptide located within the following region: FSNLTQHKRIHTGEKPYKCKECCKAFNKFSNLTQHKRIHTGEKPYKCEEC.
GeneID:
339500
Application WB
Background ZNF678 may be involved in transcriptiol regulation.
Format
Purification:
Affinity Purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn