discontinued

NBP1-82172 ZNF770 antibody

See related secondary antibodies

Search for all "ZNF770"

0.1 ml / €500.00

Quick Overview

Rabbit anti Human ZNF770

Product Description for ZNF770

Rabbit anti Human ZNF770.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for ZNF770

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6IQ21
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: SPYASLCQVEFGNFNNLSNHSGNNVNYNASQQCQAPGVQKYEVSESDQMSGVKAESQDFIPGSTGQPCLPNVLLESEQSNPFCSYSEHQE
GeneID:
54989
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 54989

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF770 (1 products)

Catalog No. Species Pres. Purity   Source  

ZNF770 overexpression lysate

ZNF770 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn