TA335102 ZP1 antibody

Rabbit polyclonal Anti-ZP1 Antibody

See related secondary antibodies

Search for all "ZP1"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZP1

Product Description for ZP1

Rabbit anti Human ZP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZP1

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ZP-1, Zona pellucida glycoprotein 1, Zona pellucida sperm-binding protein 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P60852
Immunogen:
The immunogen for anti-ZP1 antibody: synthetic peptide directed towards the middle region of human ZP1. Synthetic peptide located within the following region: TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDN.
GeneID:
22917
Application WB
Background The mammalian zo pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zo pellucida.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn