TA345621 ZSCAN2 antibody

Rabbit Polyclonal Anti-ZSCAN2 Antibody

See related secondary antibodies

Search for all "ZSCAN2"

50 µg / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZSCAN2

Product Description for ZSCAN2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ZSCAN2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZSCAN2

Product Category Primary Antibodies
Target Category
Quantity 50 µg
Synonyms ZFP29, Zfp-29, Zinc finger and SCAN domain-containing protein 2, Zinc finger protein 29 homolog
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Swiss Prot Num:
The immunogen for anti-ZSCAN2 antibody: synthetic peptide directed towards the middle region of human ZSCAN2. Synthetic peptide located within the following region: GKGFSWNSVLIIHQRIHTGEKPYKCPECGKGFSNSSNFITHQRTHMKEKL.
Application WB
Background ZSCAN2 contains several copies of zinc finger motif, which is commonly found in transcriptiol regulatory proteins. Studies in mice show that ZSCAN2 is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells.The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptiol regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Altertive splicing of this gene results in several transcript variants encoding different isoforms. The protein encoded by this gene contains several copies of zinc finger motif, which is commonly found in transcriptiol regulatory proteins. Studies in mice show that this gene is expressed during embryonic development, and specifically in the testis in adult mice, suggesting that it may play a role in regulating genes in germ cells. Altertive splicing of this gene results in several transcript variants encoding different isoforms.
Affinity Purified
Buffer System:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Accessory Products

Proteins and/or Positive Controls

Proteins for ZSCAN2 (3 products)

Catalog No. Species Pres. Purity   Source  

ZSCAN2 (transcript variant 3)

ZSCAN2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells

Regular Price: 20 µg / €680.00

Special Price: 20 µg / €748.00

  OriGene Technologies, Inc.


ZSCAN2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.


ZSCAN2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZSCAN2 (1 products)

Catalog No. Species Pres. Purity   Source  

ZSCAN2 overexpression lysate

ZSCAN2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn