H00222696-B01P ZSCAN23 antibody

See related secondary antibodies

Search for all "ZSCAN23"

0.5 mg / €1,400.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Mouse anti Human ZSCAN23

H00222696-B01P

Product Description for ZSCAN23

Mouse anti Human ZSCAN23.
Product is tested for Western blot / Immunoblot.

Properties for ZSCAN23

Product Category Primary Antibodies
Quantity 0.5 mg
Synonyms FLJ99276, MGC126606, MGC126608, ZNF390, ZNF453, dJ29K1.3, dJ29K1.3.1
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3MJ62
Immunogen:
ZSCAN23 (ABZ92213.1, 1 a.a. ~ 389 a.a) full-length human protein.
AA Sequence:
MAITLTLQTAEMQEGLLAVKVKEEEEEHSCGPESGLSRNNPHTREIFRRRFRQFCYQESPGPREALQRLQELCHQW LRPEMHTKEQILELLVLEQFLTILPEELQAWVRQHRPVSGEEAVTVLEDLERELDDPGEQVLSHAHEQEEFVKEKA TPGAAQESSNDQFQTLEEQLGYNLREVCPVQEIDGKAGTWNVELAPKREISQEVKSLIQVLGKQNGNITQIPEYGD TCDREGRLEKQRVSSSVERPYICSECGKSFTQNSILIEHQRTHTGEKPYECDECGRAFSQRSGLFQHQRLHTGEKR YQCSVCGKAFSQNAGLFHHLRIHTGEKPYQCNQCNKSFSRRSVLIKHQRIHTGERPYECEECGKNFIYHCNLIQHR KVHPVAESS
GeneID:
222696
Add. information Mouse polyclonal antibody raised against a full-length human ZSCAN23 protein.
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Format
Buffer System:
In 1x PBS, pH 7.2
Specificity
Specificity:
Antibody reactive against mammalian transfected lysate.

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZSCAN23 (1 products)

Catalog No. Species Pres. Purity   Source  

ZSCAN23 overexpression lysate

ZSCAN23 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn