NBP1-90578 ZSCAN23 antibody

See related secondary antibodies

Search for all "ZSCAN23"

0.1 ml / €500.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZSCAN23

Product Description for ZSCAN23

Rabbit anti Human ZSCAN23.
Presentation: Aff - Purified
Product is tested for Paraffin Sections.

Properties for ZSCAN23

Product Category Primary Antibodies
Quantity 0.1 ml
Presentation Aff - Purified
Reactivity Hu
Applications P
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Not USA/Canada
PDF datasheet View Datasheet
Manufacturer Novus Biologicals Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q3MJ62
Immunogen:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: HRPVSGEEAVTVLEDLERELDDPGEQVLSHAHEQEEFVKEKATPGAAQESSNDQFQTLEEQLGYNLR
GeneID:
222696
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Format
Purification:
Affinity purified
Buffer System:
Clear, colorless solution in phosphate buffered saline, pH 7.2, containing 40% glycerol
State:
Aff - Purified
Gene ID 222696

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZSCAN23 (1 products)

Catalog No. Species Pres. Purity   Source  

ZSCAN23 overexpression lysate

ZSCAN23 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn