discontinued

H00006778-B01 STAT6 antibody

See related secondary antibodies

Search for all "STAT6"

Quick Overview

Mouse anti Human STAT6

H00006778-B01

More Views

  • H00006778-B01
  • H00006778-B01

Product Description for STAT6

Mouse anti Human STAT6.
Presentation: Serum
Product is tested for ELISA (detection), Immunocytochemistry/Immunofluorescence, Western blot / Immunoblot.

Properties for STAT6

Product Category Primary Antibodies
Target Category
Quantity 50 µl
Synonyms IL-4 Stat, Signal transducer and activator of transcription 6
Presentation Serum
Reactivity Hu
Applications E(detection), ICC/IF, WB
Clonality Polyclonal
Host Mouse
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
P42226
Immunogen:
STAT6 (NP_003144.3, 1 a.a. ~ 847 a.a) full-length human protein.
AA Sequence:
MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDTVQHLQASVGEQGEGST ILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREALQ KGAEAGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERC ESLVDIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLRFLGA PAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALFKNLLLKKIKRCERKGTESVT EEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDNNAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLN LKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSY WSDRLIIGFISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRD LAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQL GPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPL LCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISM SHMDLRANPSW
GeneID:
6778
Remarks:
Gene Accession: NM_003153.3
Add. information Mouse polyclonal antibody raised against a full-length human STAT6 protein.

Antibody reactive against mammalian transfected lysate.
Application Det Ab,IF,WB-Ti,WB-Tr
Storage No additive
Format
Label:
None
Purification:
Serum
Buffer System:
No additive
Purity:
Serum
State:
Serum
Specificity
Species:
Human
Gene ID 6778
FocusOn and Reviews
Reviews:

Accessory Products

Proteins and/or Positive Controls

Proteins for STAT6 (5 products)

Catalog No. Species Pres. Purity   Source  

STAT6

STAT6 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €680.00
  OriGene Technologies, Inc.

STAT6

STAT6 Human in vitro transl.
  Abnova Taiwan Corp.

STAT6

STAT6 Human in vitro transl.
  Abnova Taiwan Corp.

STAT6

STAT6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

STAT6

STAT6 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for STAT6 (3 products)

Catalog No. Species Pres. Purity   Source  

STAT6 293T Cell Transient Overexpression Lysate(Denatured)

STAT6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

STAT6 Lysate

Western Blot: STAT6 Lysate [NBL1-16529] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for STAT6.
  Novus Biologicals Inc.

STAT6 overexpression lysate

STAT6 overexpression lysate
0.1 mg / €280.00
  OriGene Technologies, Inc.
  • LinkedIn