H00000185-Q01 AGTR1

Search for all "AGTR1"

2 µg / €300.00
Please visit the country specific website of Acris Antibodies or contact your local Distributor to buy this product.

Quick Overview

AGTR1

H00000185-Q01

Product Description for AGTR1

AGTR1.

Properties for AGTR1

Product Category Proteins & Growth Factors
Quantity 2 µg
Synonyms AG2S, AGTR1A, AGTR1B, AT1, AT1B, AT1R, AT2R1, AT2R1A, AT2R1B, HAT1R
Species (Protein) Human
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer Abnova Taiwan Corp.
Manufacturer certificates ISO 13485:2003

Datasheet Extract

Immunogen
Swiss Prot Num:
D3DNG8
Add. information 12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Application AP, Array, ELISA, WB-Re
Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Best use within three months from the date of receipt of this protein.
Description
AA Sequence:
FFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKYIPPKAK SHSNLSTKMSTLSYRHSDNVSSSTKKPAPCFEVE
Format
Buffer System:
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • LinkedIn